DPCstruct | MC23741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 86 ± 11 aa |
| Standard deviation of domain lengths | 10.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8Q920 | 1-80 | MVEAWYMDESADDPRRPHRAEPNRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRKERNYSWMDIITICKDKLPNYEEK |
| A0A0A9RJC0 | 14-103 | EAWYMDDSQEDQRLPHHREPKEFIPLDKLSELGIVSWRLNPDNWENDENLKKIREARGYSYMDICDVCPEKLPNYETKIKNFFEEHL… |
| A0A3P7HZU4 | 1-81 | None |
| A0A4D6N3D6 | 2-84 | None |
| A0A6A4WFZ6 | 1-86 | None |
| A0A6A0AEI1 | 90-171 | None |
| A0A7R9QIZ1 | 1-104 | None |
| A0A426Z7J2 | 88-163 | None |
| A0A4S4EFW2 | 24-118 | None |
| A0A4W2IMQ3 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.