DPCstruct | MC2374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 178 ± 11 aa |
| Standard deviation of domain lengths | 11.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V2QVH1 | 244-408 | RAHENLYSYKDYDSPLSDRVREGHEDIDGDIELETHNPYIYVKAEGHAVYGDLRWEEKGFPGGDGVVYRYTGQAEEPQNGNDRNVGY… |
| A0A1H9XVU5 | 1-164 | MAHSDFYSYVPAGSPYRNGSETIDGTLLLVGGRPATFQEAKGHGLYRWNGGDFPGGDGVVYQPAATGEVPSGGNDRTVGYRLVNTLE… |
| A0A3A0ALY5 | 158-339 | None |
| A0A6V6YEP1 | 19-187 | None |
| A0A2T4VKU4 | 134-314 | None |
| A0A6N6S858 | 273-464 | None |
| A0A2D0N0T2 | 178-372 | None |
| A0A810M2K4 | 1-166 | None |
| A0A2A8XW85 | 129-304 | None |
| A0A524ACZ8 | 132-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.