DPCstruct | MC23739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 139 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A022XS52 | 1-128 | MQYTPFISDIELPFYSSLASLKVDHDKLDDSARKVLGLYEIKPSDRPEESCRMQILGNALLKDDVPAGYYRAEGVIKNVNTIEEYRN… |
| A0A7F8Q6U6 | 6-142 | GDPGLSKLQFAPFSSALDVGFWHELTQRKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPAHCCPAVGTLFNTNT… |
| A0A0G4LXW2 | 3-135 | None |
| A0A1X7SZ40 | 115-288 | None |
| A0A1X7SRE1 | 1-110 | None |
| A0A395IDS0 | 90-188 | None |
| A0A6P5N8A0 | 8-138 | None |
| A0A1B0BU60 | 5-122 | None |
| A0A146I083 | 288-435 | None |
| R9PAQ8 | 485-652 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.