DPCstruct | MC23738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 190 ± 16 aa |
| Standard deviation of domain lengths | 16.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S3T8D2 | 74-258 | ETQLRFLLTSIKLGHQKRHQVWFAKKFLNEPDKEFVIIDIVRFICCAHHPPNEIIQSDIVPRWALIGWLLTSCRRNDVVANVKLALF… |
| A0A7F8Q0T3 | 1-201 | METKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLAL… |
| A0A4S8IG44 | 442-625 | None |
| A0A6P4EMV3 | 1-201 | None |
| A0A0D3CSL9 | 181-334 | None |
| A0A6I9Z0V9 | 179-369 | None |
| A0A1I8F404 | 150-323 | None |
| A0A4P9Y224 | 70-267 | None |
| A9SW76 | 8-192 | None |
| A0A210PMU0 | 279-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.