DPCstruct | MC23737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 421 ± 78 aa |
| Standard deviation of domain lengths | 77.99 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7SQ86 | 54-421 | DIITENGFKYLYMKIFMVDRTIVTPYYAPNRIMHFEFVKCFLCEEFQLIELINFLTTKFLTVEIIGIRTVNVIKSTFTSEQLNYDRS… |
| A0A7F8PY84 | 2-443 | GSPAKYQVTRLCIPVYCKYQFFKTPVHRTEGRPHGIHIHFQDINVIFLGAMQPSDLREYLEGPPMVVQVHDRDRKLEEYFRKPTLFG… |
| A0A0A9XJV3 | 69-500 | None |
| A0A7S3KUT2 | 12-364 | None |
| A0A507FGM8 | 635-1077 | None |
| A0A2G8L4W5 | 2-435 | None |
| H3A4N6 | 6-468 | None |
| A0A226NUK4 | 65-364 | None |
| A0A819H405 | 394-726 | None |
| F6T3M6 | 3-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.