DPCstruct | MC23735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PW48 | 323-419 | HHTNPVGTEWKWSLDDPELVFAGALSNHYQMINEFKGVPGVQTQRLNEAMKVRHCALSLVGEPIMYPHINSFVRMLHNKQISTFLVT… |
| A0A1I8GUI2 | 281-360 | DPPDEILSGALDAHRRMIREFRGVPGVMPERISEGMQPRHCALSLVGEPIMYPRINQLLHLLHTSGISSFLVTNAQFPEA |
| A0A5J5VRT4 | 1-85 | None |
| A0A7S1XQM9 | 121-220 | None |
| A0A0C2ICF2 | 73-171 | None |
| A0A7J6LW53 | 294-393 | None |
| A0A7S0E1U0 | 235-329 | None |
| A0A167XRT7 | 768-864 | None |
| A0A0E9NJ67 | 962-1058 | None |
| A0A0B0MPH7 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.