DPCstruct | MC23734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 12.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A556TU15 | 38-147 | KSVFGDQLAVLRSPQYVNFRSGDWPLSGEKIPDLVALTMGFSVPEDLGWSGLAAGSLFQRPRANALITIRGVDSLDLPSNVSSYPLE… |
| A0A2U3YZ43 | 1-125 | MAALVVLLSLLAAGVLGNEFSILRSPGSVVFRDGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATIMVMVKGVDKL… |
| U4UUP2 | 330-463 | None |
| A0A673GF63 | 14-109 | None |
| A0A194RQ10 | 5-136 | None |
| A0A182KGB7 | 129-248 | None |
| A0A3Q0IR94 | 16-139 | None |
| A0A4W4FHG4 | 46-148 | None |
| A0A2J8WIT2 | 1-132 | None |
| A0A7R9IJD7 | 3-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.