DPCstruct | MC23732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 153 ± 21 aa |
| Standard deviation of domain lengths | 21.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9PHI2 | 2-117 | RLADFLNNCQPSPLTASGCLKDSAGLCLRAYAGLIGTIMTPNYLSNSSADVSLWCNCEGSGNQWQDCLRLQRMFTHNPCLRNSISWM… |
| A0A2U3YT17 | 57-181 | RLADFHANCRASYQTLTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQ… |
| A0A553NJ51 | 253-405 | None |
| A0A368G9V2 | 2-179 | None |
| G3IDM0 | 34-180 | None |
| E9IFY0 | 485-664 | None |
| A0A3Q7X8K1 | 281-430 | None |
| H2P1C3 | 107-251 | None |
| A0A4W2BWV6 | 346-507 | None |
| B0WU08 | 64-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.