DPCstruct | MC23730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Standard deviation of domain lengths | 12.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1RH35 | 3-68 | SSFSAYRQLCPPGCTSCSAINGCITCQPNLFLFLARSGMRQQGICTHSCPTGYYGVRRHNYSICYK |
| A0A2U3YQK3 | 22-90 | RRKKQVGTGLGGNCTGCVICSEENGCSTCQQRLFLFIRREGIRQYGKCVHDCPSGYFGVRGQEVNRCKS |
| A0A452T0U8 | 8-73 | None |
| G1SE19 | 217-311 | None |
| A0A3Q2QGS0 | 7-72 | None |
| A0A4W4HQ66 | 1-96 | None |
| A0A0P7V447 | 24-100 | None |
| A0A1V4KH50 | 14-95 | None |
| A0A1S3KDW1 | 3-96 | None |
| L5MCS7 | 3-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.