DPCstruct | MC2373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9V1Q2 | 2-65 | AVLLVRKRAGVVGETQRTCHLVPVPDGDTPLALTAYCGELIRQGEAELLDRPSGMPCVDCLFRV |
| A0A1H0SYW1 | 9-84 | IVPILLVRLRPGPGVRETQRVVHVVPVPETDGVLPDVLTAWCAFKIQPGAAEVLERFAGMPCERCLAKAPTPEGKR |
| A0A5M7B5X3 | 2-68 | None |
| W7T2A8 | 2-70 | None |
| A0A1H8YQN0 | 49-118 | None |
| A0A229TI75 | 57-127 | None |
| A0A1Q9V5T2 | 2-72 | None |
| A0A1I1ZCT8 | 3-67 | None |
| A0A5N8X8E0 | 2-76 | None |
| A0A853ATT1 | 4-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.