DPCstruct | MC23724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 160 ± 22 aa |
| Standard deviation of domain lengths | 22.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.00 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | PF02092- CL0258- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9G3K0 | 164-289 | MGEDYARKAGEKEEVAKAVFEHYQPRFSGDAVPSTQAGSIVSIADKIDTIVGCFSIGIIPTGSQDPYALRRQAAGIVQIMLEHKLPI… |
| G5GSB7 | 2-154 | GGEDAALDGEKLAVACAIDEQYMPRFAGDELPQSALGFALSVADKIDNIVGTFSRGKIPTGSQDPFALRRQALGLVLMLIENESDLL… |
| A0A816NH46 | 396-571 | None |
| A0A6A6MBP3 | 151-279 | None |
| A0A0F3GXU4 | 287-475 | None |
| A0A2N9HX27 | 291-440 | None |
| A0A7C4H2U8 | 7-148 | None |
| A0A5S9MB94 | 287-448 | None |
| A0A830C2X3 | 12-163 | None |
| A0A6A2YRW7 | 295-425 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.