DPCstruct | MC23722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 147 ± 24 aa |
| Standard deviation of domain lengths | 23.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9R9W1 | 4-128 | TGGNGTGLSYYLKYAEDSTEDDPTIIAKGVDENGNEFEKTIHINEINPKSATVVEMRALEAHMGVKKLGGFTSLPMEAGAMGLNDRT… |
| A0A1I6XNS3 | 43-200 | HAVGNAMSLTSIAYDENLSYGMMAFHSDRSTAEDPIIKISCNYGGEQRYYDVHVKEVNPSNASTLEMFAWCTWADENGITERGTFGS… |
| A0A2G3DW08 | 3-153 | None |
| A0A1I7FBN6 | 45-184 | None |
| A0A1G8LT21 | 172-341 | None |
| A0A1H6T054 | 1-172 | None |
| A0A3A9GCL4 | 1-196 | None |
| R9IHV6 | 268-396 | None |
| A0A1G5DA49 | 52-218 | None |
| A0A374HNG6 | 28-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.