DPCstruct | MC2372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402CYY7 | 1-95 | MGIYNCLHTEVQCPRCGARTEAIIDLYFGFKNLLEYHLGDIYQWRERKQPQNGGRPDGGNVDGEGYTECAICRKASFWIVEVRSDIL… |
| A0A1H9B324 | 1-115 | MGMYNYLVLHGLTCPRCGHTADHTVQFHFGHVTLHDYEIGDTLRWSPRQRDNRGEPGHHRVVTEGLTGAHPDCDGPFGPRRWPDDDL… |
| A0A413W7N5 | 1-93 | None |
| A0A5P6VL53 | 1-94 | None |
| A0A4V0I0C4 | 1-92 | None |
| A0A133UJX4 | 1-107 | None |
| A0A133V1J8 | 1-113 | None |
| A0A1V1P2L8 | 1-99 | None |
| A0A3A8PWA4 | 1-102 | None |
| A0A1M5JFR3 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.