DPCstruct | MC23717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 243 ± 23 aa |
| Standard deviation of domain lengths | 22.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3Y7W9 | 2-254 | AFGGGLNETQEKAVGDVLKIKEQNYKTLKVEGSDVDHYLHIIGAKTSGLFSSVYITRTVREGQNVVKVLTPKNIVLVTEAGYTTPLT… |
| A0A3B9WTZ6 | 91-324 | GNEVGEENVDSQLYLALGNDLNKQQLGTVLQLMDISQEEYANADVVYVTNEEEHTFLDPYIDPSLIGKNALSSVLVRPMEEDYGVRV… |
| A0A4R9C0P1 | 22-281 | None |
| Q3EJ08 | 16-244 | None |
| A0A1E8YG51 | 28-270 | None |
| A0A416N089 | 6-239 | None |
| K1LDV6 | 27-264 | None |
| A0A133YH30 | 126-398 | None |
| A0A1C6HH52 | 105-355 | None |
| H3NKR7 | 24-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.