DPCstruct | MC23714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 132 ± 15 aa |
| Standard deviation of domain lengths | 15.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 15.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6HEP8 | 15-142 | LSGSDLVSDYALLAKRYFKFLIDDFKYKLVKDTRESMSHVIEYQGNNRKIRLNFDLRDNFFYFRIYNGLDVKYSDTDRENIKVFPDL… |
| A0A2E4EM74 | 25-168 | SDHELAFAQVILNIIGPTVEKHDFVLHNKEIKKYSTTIIWRKKKQYVKVNSTTYPRDYPYHYNIIVGEGNSDDFLEYDWNSVAIWAL… |
| A0A7Y0Q5M3 | 3-138 | None |
| A0A522X9B6 | 1-134 | None |
| A0A536JAK0 | 20-156 | None |
| A0A4Q3SET4 | 1-112 | None |
| A0A497C9C0 | 1-144 | None |
| A0A3B8J5U5 | 20-192 | None |
| A0A536QM01 | 3-150 | None |
| A0A5E5QQ87 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.