DPCstruct | MC23712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 25.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F3NTC9 | 1-107 | MAMKQFIERMVIHVRKHFPEESKSMDGEQLKNHIRDVIPVAKKYGLVSERDICKYINLSMFYGTGFDKKPENDWMARMLMDSSEPNP… |
| Q1CYM0 | 170-289 | FIIRTQQGLTLQHASEARFRREMVEHLRTHFPERTTGLEARELDAHVERALQAARDYGLASRRELCRFLNLCGLHGWDFDRRPRNAW… |
| A0A7Y4N528 | 105-214 | None |
| A0A3A0BC39 | 1-106 | None |
| A0A2H5WYA3 | 1-120 | None |
| A0A4U1IH05 | 1-110 | None |
| A0A2V8MHZ4 | 147-259 | None |
| A0A2T6FE36 | 1-123 | None |
| A0A150SP52 | 2-97 | None |
| A0A1Q9QVK7 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.