DPCstruct | MC23709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 195 ± 14 aa |
| Standard deviation of domain lengths | 13.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.31 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF02814- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378A8S9 | 66-267 | SSDSQAMGRVGENWLRVVQTAHAMKVARGKLPEDSDGNDNFRVLRYVAKLTINPAIAHGVSHIIGSVEVGKMADLVLWDPRSFGAKP… |
| F9FUC7 | 5-183 | SQAMGRSAEVLTCTWKAAHKNKVQRGPLDEDKDTGADNFRVKRFISKYTINPAITQGISHAVGSIEAGKLADLAIWDPAEFGTKPFQ… |
| A0A6A3B9W3 | 383-579 | None |
| A0A3S4NQ97 | 472-657 | None |
| G8S4B6 | 319-508 | None |
| A0A7K2XYX2 | 77-275 | None |
| A0A066YSE0 | 826-1024 | None |
| A0A6A5LA80 | 360-555 | None |
| A0A1Q9D7U7 | 30-251 | None |
| A0A263HEL9 | 323-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.