DPCstruct | MC23708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 143 ± 20 aa |
| Standard deviation of domain lengths | 19.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1DKH2 | 130-281 | VDRFHAHRQWLHLYWCYHKRLSQMSVDDFAEFCFECDMWFNNRNKWRQHCEDHLSKPTELLRCDLIIFRNCPVKPGYCPFCLGNTSL… |
| F9FJL1 | 63-203 | SPFVQFCSICNRWVKGESEWTIHCQDHIANRQSPFRCDPIILRNAIACPGYCLVHLGSHEYPANHRLQQFWDQSGRQRHASVCVSAF… |
| A0A1L9PDH3 | 228-373 | None |
| A0A2V1CWR1 | 209-328 | None |
| K2SAG8 | 289-414 | None |
| A0A834RV71 | 2-154 | None |
| A0A317A6E7 | 1-153 | None |
| A0A1B8FTC8 | 198-357 | None |
| A0A1L9U3T0 | 8-138 | None |
| A0A4Q4U6Z9 | 770-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.