DPCstruct | MC23707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 267 ± 18 aa |
| Standard deviation of domain lengths | 17.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R9HZF7 | 10-260 | VIDQIYKEINKLLGTQNQLFCMEFPGRVLNEDTYAYKNDAIYSILTKPQPVIEQEFRLSDDLFDVSQISAGPNGSKLSTTYESVINL… |
| F9FEZ5 | 1-288 | MADKNKLEAEMAARAAAVSQQVREALQSSLPVAPEQMMTVQIPGTVINAKEKGPYWFNPKEHAETPHRIKVHEARLVDGMVPLSKIM… |
| B0D5G9 | 1-308 | None |
| A0A3L6MV61 | 6-274 | None |
| A0A6M7ZR77 | 19-274 | None |
| A0A0J9WSI5 | 19-274 | None |
| A0A0S7DL54 | 23-273 | None |
| H0EZ17 | 3-253 | None |
| A0A6P0N1Y4 | 26-278 | None |
| A0A428SVS9 | 14-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.