DPCstruct | MC23701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 2.80 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1YPK5 | 1-73 | MRLDPVSVAREGEAALRERLAALSFEQLRDIVADYGMDPGKLVMKWKDQARVLDRIVEVSISQAAKGDAFRAD |
| A0A5A7Y249 | 2-81 | RKGRRAPGPWDPFDVYADVGEAGLRDKLSALGIEQLRDIVAEHGFNNDGLAMRWTKADRVAGRIVDRVVEKATKGYAFRR |
| B4W3T1 | 55-132 | None |
| A0A157SP20 | 58-137 | None |
| A0A1E3Y7Q1 | 9-87 | None |
| A0A6Y1UJC4 | 47-120 | None |
| A0A512DCZ4 | 73-153 | None |
| A0A0M8VQN0 | 67-147 | None |
| A0A285UMW3 | 74-154 | None |
| A0A7X8BA31 | 232-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.