DPCstruct | MC2370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 183 ± 12 aa |
| Standard deviation of domain lengths | 11.67 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4QYE4 | 130-311 | VPSAVRSTTPVAADATDSGVAVVPPPGALPDGTAAVVPGPPVSPGFSATAVPGGVATSAPAAVPGTARPADAIAEWARVTGAKVGVS… |
| A0A7V9LYQ8 | 52-217 | LVGVAISSLVAGSSVGGAAASTDSQASDTQLAALQLGMGGQAVPSGLPWAMVPDNAGKGRGTLPRVPSPTTVPVSEVTDLGIPDVAL… |
| A0A516X2D7 | 26-231 | None |
| A0A238VDJ1 | 338-518 | None |
| A0A7Y9RQY4 | 8-198 | None |
| A1SKG1 | 5-184 | None |
| A0A7J9WN94 | 47-215 | None |
| A0A162JN80 | 8-180 | None |
| A0A7X6KZV6 | 1-190 | None |
| A0A7V9IUV9 | 2-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.