DPCstruct | MC237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 150 ± 14 aa |
| Standard deviation of domain lengths | 14.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8HGS8 | 7-151 | KAQDDLVQALARARDLKPRLEAAADELNRSIEAVESTLSNMQLGVRASITMESLDEDGWSRDLTFGKESRTWRLLIEDGFSDPEMPH… |
| A0A2V9ICF7 | 1-160 | MNNNPPKERIASSFKQLSVVSTDLNLAADEFSKTISTLDEALKSLKLGVSAWHKVAGHEDEQYGDFWTRDIGYAQVKGKWGIAIRKT… |
| A0A0B8WC77 | 5-152 | None |
| A0A5C5ZI12 | 4-173 | None |
| A0A7X6UML3 | 21-169 | None |
| A0A7Y0MIT2 | 6-153 | None |
| A0A2V9XS03 | 5-129 | None |
| A0A6I6AD80 | 1-131 | None |
| A0A2N0DYE9 | 4-149 | None |
| A0A4Y7B296 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.