DPCstruct | MC23696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0DEI5 | 122-207 | NTTYTLNYAHEYYNEPVGGLDFNQDDSPRYSDFAYVAFTIGMTFTVPDVTVQSSTLRRATLGHALLSFVFSTGLLAIVVSLIPSLA |
| A0A7W4YFR3 | 2-84 | LFTLRYAGVYYRSGGTGVDFNQPEPPEYRDFAYLALTIGMTYQVSDTNLTSTCIRREALRHALLSFILGVTVLAAMVNLVSAL |
| A0A7Z0ILH6 | 131-214 | None |
| A0A2H6LAR0 | 5-89 | None |
| I0W946 | 55-146 | None |
| A0A534NNB5 | 239-326 | None |
| X1WQ86 | 53-137 | None |
| A0A4Z0PIL7 | 19-105 | None |
| A0A258Q9E6 | 66-166 | None |
| A0A0K8Q3E4 | 78-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.