DPCstruct | MC23694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 46 ± 4 aa |
| Standard deviation of domain lengths | 4.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.13 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 66.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834ZYD4 | 82-124 | LDLAGTFGRDAMLVHSSGEILPVNEHGVLMKSLQMGECYYLVS |
| A0A4Y7L1Q7 | 151-193 | LDMKSMFGQDAMLVHSSGVPVPFNEYGFSLQSLQMGESYFLVS |
| A0A6V7PQQ4 | 129-171 | None |
| I1I285 | 197-239 | None |
| A0A2I0ASR3 | 104-148 | None |
| A0A453AN29 | 26-74 | None |
| A0A287H7C7 | 1-43 | None |
| A0A0E0LSS1 | 351-393 | None |
| A0A287H7E4 | 42-94 | None |
| J3LND3 | 134-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.