DPCstruct | MC23693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7EXS2 | 121-189 | LNNGEMMERRWLVYSLLQDTVYCFSCKLFAPIPIALATGGFNDWKHLAERLKEHENLQNHREGMIKWTK |
| A0A287H6B8 | 1-67 | MHDRKWLFYSKHVDKVYCFCCKLFKSHNNKSSLACNGLKDWKHLSERLKEHENGVEHIRNMNTWNEF |
| A0A3L6GB40 | 367-447 | None |
| H3A1S4 | 1-72 | None |
| A0A0R0GC97 | 284-365 | None |
| A0A5D2MZ04 | 23-104 | None |
| A0A2S2PXL5 | 16-79 | None |
| A0A3L6FJR3 | 266-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.