DPCstruct | MC23691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 581 ± 169 aa |
| Standard deviation of domain lengths | 169.07 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 36.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8LLH3 | 399-1099 | LLSHIVNLTLHHGGFLWTQHGGRTEGQPPHHYAFQTVRIQDGSTINSTTDPIDEPGITFITESIYIEGGGILHGTKLTMISENITID… |
| A0A287GXU2 | 1-625 | AWAFLDNPWSYGSKGGSLSANEKLGGDGGGRVLLRASEILTVDGVVLAEGGVGSLRGGGGSGGSIMIMAFKLYGNGTISAGGGNGWG… |
| A0A7Y5EPU8 | 174-937 | None |
| A0A453E6Z2 | 2-387 | None |
| A0A453E6Z4 | 132-730 | None |
| A0A3R6ZU38 | 132-532 | None |
| A0A453A9X6 | 92-480 | None |
| A0A5A8D0N2 | 7-667 | None |
| A0A453AA23 | 72-428 | None |
| A0A6P6SHP1 | 48-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.