DPCstruct | MC23690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 89 ± 15 aa |
| Standard deviation of domain lengths | 15.02 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182G1R2 | 353-426 | DEPKIDHIIYQFVYNNNSRQQTETKSDFHCPWCSLNCGTLYPLLKHLKLCHARFIFTYIPIPPNGARIDVSINE |
| A0A183JEX0 | 506-591 | HPITYGFVFGGNLQQWSQSTDLVCPWCHLDCARAGDKGPEALILHLRTCHPRFRLKVIWDPSHTQLSLQVSLNEAYDGSNDCGIRR |
| A0A0R0HS33 | 76-169 | None |
| A0A7S3BW89 | 139-211 | None |
| A0A820L2S1 | 67-143 | None |
| A0A1U7Y1Z0 | 68-145 | None |
| A0A452XBB1 | 2-110 | None |
| A0A093XVL5 | 338-416 | None |
| A0A481NWA7 | 343-445 | None |
| A0A811NRN0 | 212-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.