DPCstruct | MC2369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 192 ± 10 aa |
| Standard deviation of domain lengths | 9.57 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A3TH40 | 100-284 | LGGDANFWTKVGIDPIRIITDNGTFFTLRCYLGDQPVFLGRNGRISVFGSERALARYLADEHDHDLSDLSTYDDIRTAATDGSLSID… |
| A0A7V9LV33 | 51-238 | SEDSRAATEFWESVGILPVRLIFREGSGLTLRCYVEDTARFLGSELTVDVFRTPDGLSTFVEEGEPNDLATLSTWGAVVEADADPIA… |
| A0A327Z636 | 1-179 | None |
| A0A7U8YMZ7 | 8-201 | None |
| A0A3P1BFX1 | 1-205 | None |
| A0A1M5G955 | 8-186 | None |
| A0A562M9H2 | 222-412 | None |
| A0A0M3TBP1 | 214-406 | None |
| A0A849A5X9 | 276-479 | None |
| A0A495JPF7 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.