DPCstruct | MC23688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 62.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9L365 | 31-88 | EALNEGTMDCFFILSSQFRTQDEPAYCGLSTLVMVLNALSVDPGKVWKAPWRWYHESM |
| A0A287GDM7 | 1-70 | MEALQGGTMEGFFNLISYFQTQSEPAFCSLASLSVVLNVLAIDPGRLWKGPWRWFVTCIIFGRGRSALAD |
| A0A0V0JC02 | 92-147 | None |
| A0A158QED0 | 76-145 | None |
| A0A6G1EHH2 | 49-106 | None |
| A0A2U1NG81 | 29-87 | None |
| A0A4S4D040 | 146-215 | None |
| A0A2Z6MSX3 | 29-91 | None |
| A0A2I0WNG2 | 30-87 | None |
| A0A0G4FHW5 | 30-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.