DPCstruct | MC23687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2IV00 | 157-261 | GLSRAPQFVSQPQTNSIWADEVDAVVIPHTACGGSAILSFSGGNTRIITVKDNTTALNVTPEYLGMETITVNSYLEALGVLVAHKAG… |
| A0A7C7JTD2 | 2-135 | CVLKGLQRSPKILTDEESMREPGVFTARDVSCLVIPNGCLGLPTLAALEQGIPVIAVRENTNLMKNDLTELPWAIGQLHIVENYWEA… |
| A0A7C1RIE5 | 46-147 | None |
| A0A7J7L8F4 | 186-322 | None |
| A0A1E3XDC2 | 8-144 | None |
| A0A811PDZ1 | 256-389 | None |
| A0A5N6PUS5 | 486-591 | None |
| A0A2U1QN83 | 237-373 | None |
| A0A2U1QGG8 | 620-732 | None |
| A0A6A3AW49 | 70-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.