DPCstruct | MC23686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 237 ± 56 aa |
| Standard deviation of domain lengths | 55.78 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.21 |
| Pfam Score | 65.15 |
| Assigned Pfam label(s) | CL0039- CL0020- PF19269- CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0CBM2 | 5-184 | FDIADVNANPARFDLKKAEHVNAEHVRRLDVRAFTEACGPWLKAPFAPWAPEAFDAEQFATIAPYAQTRLTVLSEITANVDFLFLDE… |
| A0A7C7JTA9 | 30-246 | SVQEMKAQGYPPGAVLNYVSLLGWSHPEEKEILSNEELVASMSLDRVGRSDCQLDPDKFRWVSAQHLAQESLEGLVDHVAPFIDRDR… |
| A0A7J8IYP3 | 9-198 | None |
| A0A7S3GE92 | 11-212 | None |
| A0A0B7N3Q9 | 993-1226 | None |
| A0A841CY10 | 161-444 | None |
| U6JPW0 | 335-598 | None |
| A0A0N0XAC2 | 19-291 | None |
| A0A5A7QT40 | 516-757 | None |
| Q119Z5 | 229-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.