DPCstruct | MC23680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 7.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1TKK5 | 2-66 | FTPDVNRGGRYQTGEKGNERYYDSFDKALAALQAMPVAKWRRPNSEGNWGIVSAVDWRRVDRNTL |
| X7F5U9 | 5-74 | PVARDGSLFHPDLVRGGKYQIGAKGEEQHFDNFDDALAALNAMPIPRWRRPNEQGHWGIVSGVAWQRVER |
| A0A1H3ZG80 | 218-284 | None |
| A0A2D5F6M4 | 164-237 | None |
| A0A1Z9QX87 | 226-298 | None |
| A0A2G2JTG8 | 169-237 | None |
| A0A4P7YWD3 | 1-63 | None |
| A0A2K1FR56 | 180-249 | None |
| A0A7W4I7F9 | 275-356 | None |
| A0A149S8X2 | 3-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.