DPCstruct | MC2368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 15.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q2CMU3 | 4-108 | LSHAQRLIIEAEYADPPAARFGVAYRAAQQIALAVIAASPRRVRGRTDAWELLAAAAPELGEWAAYFGVYAPAAKAGVASERIAADM… |
| A0A7V9IR69 | 20-161 | TQLALLRPRRAVSPSALVLLGQAQVGLAEAAQLPSSGERYAGAHLAALRATAAVLAARANPDTHAGSGSRRRRRLRSAWDLLCEVAP… |
| A0A259PP43 | 7-134 | None |
| A0A6G7Y812 | 81-202 | None |
| A0A4P8PZF9 | 3-123 | None |
| A0A852VUR8 | 153-279 | None |
| A0A428WXU7 | 98-236 | None |
| K6WVF4 | 45-194 | None |
| A0A6N7HVF0 | 11-127 | None |
| A0A2N9JHC6 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.