DPCstruct | MC23677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 372 ± 56 aa |
| Standard deviation of domain lengths | 56.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0YQT2 | 1-290 | MTVTALVASLNPAIVARQNTGVDSEEIQVLQKLLLEEIRSKHPEAMYPAALCTLADLLEIEEQDGLDKAIASGSEQEAVARCTCRSE… |
| A0A6P6H659 | 24-398 | VAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYM… |
| A0A812AST4 | 1-405 | None |
| A0A5K3F810 | 440-806 | None |
| A0A6G0HIB0 | 126-470 | None |
| A0A177AWE0 | 228-537 | None |
| A0A4Y7N276 | 12-335 | None |
| A0A437CBM0 | 9-400 | None |
| A0A132AAT2 | 412-818 | None |
| S4REI0 | 2-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.