DPCstruct | MC23674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 136 ± 10 aa |
| Standard deviation of domain lengths | 9.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8CNY8 | 2-134 | EEKPTTTTLSTIAISAKNNATIVLAMLKSIDYIELRITEMKPGLLEIGGNLGKSTTLLALHNDLMARLSSKQDQVDELLNRANQLVG… |
| A0A151JAN5 | 28-164 | DEDTPQQIISPTTTISTIAVQSGETRVVIALLQSGEWLKLKILELQPELTKLGASVKEAMELSNAHDQVLLRLQNKQSPVEELLRQA… |
| K7FTI7 | 1-137 | None |
| A0A1I7XK83 | 21-170 | None |
| A0A0N4XCU4 | 22-169 | None |
| K7IC64 | 1-117 | None |
| B0S755 | 1-127 | None |
| J9ER24 | 1-143 | None |
| A0A3B1JY61 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.