DPCstruct | MC23672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 149 ± 37 aa |
| Standard deviation of domain lengths | 37.36 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 73.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8CDQ2 | 174-332 | EDFGFGTSKVLLAEEELDKPGPSTLNKPPREGYEDSLGSENEEIEAPIGKLSDEDDLIRLKLQLLVANFDKVQMERFEIYRRANFPR… |
| A0A540NG21 | 3-105 | KMQAILSQFSEEQMSRYESFRRAGFQRANMKRLLTSISGTPKISAPMNIVVSGIAKMFVGELVETARIVMSERKESGPIRPCHLREA… |
| A0A0C2MII9 | 1-93 | None |
| H0EHB5 | 11-191 | None |
| A0A084R3L7 | 69-296 | None |
| A0A3N4IN71 | 9-115 | None |
| A0A553P179 | 62-184 | None |
| T1EEK4 | 13-130 | None |
| A0A4U5M0W9 | 4-117 | None |
| A0A4U5QEQ2 | 13-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.