DPCstruct | MC23671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 2.55 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 81.86 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF00010- PF01586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815P8J3 | 194-249 | VDRRKAATMRERRRLRKVNEAFETLKRRTCPNPSQRLPKVEILRNAIEYIENLEDL |
| A0A2H1C6J6 | 3-58 | VDRRKAATMRERRRLRKVNEAFETLKRRTCANPNQRMPKVEILRNAIDYIENLEEM |
| A0A7E6FUT6 | 221-276 | None |
| A0A1B0AVC0 | 153-212 | None |
| A0A7M4E604 | 79-140 | None |
| A0A4Z2G6F1 | 102-163 | None |
| A0A4W3GAX1 | 6-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.