DPCstruct | MC23670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 140 ± 22 aa |
| Standard deviation of domain lengths | 21.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.18 |
| Pfam Score | 99.28 |
| Assigned Pfam label(s) | CL0159- PF01682 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4X3PQ18 | 4-117 | ATDPNYLFVACCAERGLSVACQTVCNFREYNQNLLQNMLIGSHECPLDSLADMQFCAAQGRDHRDCCVRRGVNAVAAGDKCLVFCDQ… |
| A0A1I8C8V5 | 24-166 | LNGDENSVEDNKVLPSTYQQTTELQSTSPNQEFLNCCQSRGLPDACNEVCSYENYSRKTLQQMFFNAFGCPLSAVSNIHFCASKGRD… |
| A0A0M3I3X6 | 15-135 | None |
| A0A2H2IAT1 | 287-433 | None |
| A0A6V7TI75 | 58-216 | None |
| A0A368GGQ2 | 53-203 | None |
| A0A0K0E4G4 | 58-196 | None |
| A0A0R3Q4F8 | 1-131 | None |
| A0A811LCD7 | 1009-1128 | None |
| A0A0K0E2K5 | 854-997 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.