DPCstruct | MC2367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 127 ± 25 aa |
| Standard deviation of domain lengths | 24.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1NR11 | 23-157 | LPEPEPPAPEGEAARACRSLYAALPEHIEDQPRRPLSEETEYAAAWGDPSITLRCGTGRPAVLDPAGGEYNPAADAVVVNDVAWLAE… |
| A0A7V9E4X8 | 9-118 | CPTLMGGLPLVLADSQARPVRSASAYAAAWGDPPIVLRCGVPAPPELAADSSLLQINGVAWFTEPGEDGTVWTAVDREVYVDVQVPS… |
| A0A354XQL0 | 22-146 | None |
| A0A7R7GVU1 | 2-84 | None |
| A0A2A6FTN8 | 41-178 | None |
| A0A4R8D1T4 | 69-202 | None |
| A0A6G3W2L4 | 17-154 | None |
| A0A098BK95 | 222-358 | None |
| A0A3R8VF86 | 23-146 | None |
| A0A1Q5Q4D7 | 4-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.