DPCstruct | MC23669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 474 ± 85 aa |
| Standard deviation of domain lengths | 84.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 17.97 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF08320- PF04113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498LTZ6 | 150-471 | HISFTQGFWRTMQWGQPFIPSPPGAELWVWFHDTVSDVDGNWKELTNVLSGIFCASLNFIDLTNTVQPSASFKPLGLGNVTDHRFLR… |
| A0A1I8C6J2 | 678-1129 | PKTIADLSSTHHFDQLHLSLAFSNWWTSDWGYQPQPEIPVGASFKVTFAKETIDVDSKWGDLVQALNGIFCGSWTNLHPTHTKTTSA… |
| A0A421JWH9 | 4-467 | None |
| A0A7J0FVR3 | 31-649 | None |
| A0A4Y7NK19 | 387-889 | None |
| A0A4Z2DIA8 | 21-554 | None |
| A0A7R8D928 | 15-436 | None |
| A0A7R9FV84 | 12-535 | None |
| A0A1J1IQG9 | 419-956 | None |
| A0A7J6PR13 | 18-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.