DPCstruct | MC23668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 7.81 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 46.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6KCH6 | 1-128 | MAAFANKSGMSFVPSSILESRKDLQEYHELEKEMHKKHKVVPDTPYICGVCGAKKKTHADLEKHFKTLHERERNKKLNRASSLKGAK… |
| A0A835QII3 | 76-197 | VAYANSHTFRHVPAPVRTARAARRAFDRLEDSGAVPPPSEPYICRVCGRNFYIHSKLLNHFKIHEREHTKRLRRLDSATGSRYVRLK… |
| M7UEA1 | 3-128 | None |
| A9SMQ2 | 37-158 | None |
| A0A6A3CHU4 | 1-132 | None |
| A0A803LR16 | 1-122 | None |
| A0A6V7PAH8 | 371-493 | None |
| A0A194VDJ7 | 112-231 | None |
| F6H5L7 | 1-133 | None |
| A0A4Y7LFR7 | 13-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.