DPCstruct | MC23667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 175 ± 37 aa |
| Standard deviation of domain lengths | 37.01 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.20 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0123- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3MIH0 | 7-176 | ILDEIMNELKISPTINSKKFSDTKELDHSMVVGQIMSLSSVPDLVSVSKETTTHWTLTTEGEDIVKNGSYEYRLYSSIPETGIFIKE… |
| A0A2U1PEM0 | 2-186 | AEDAILTYLDKNELIVDSGEFAVEVGISHEEIVNAIKSLMYSKSVNAQDIKKESCKLTDEGKTYAAKGSPEYQLFMAIPPEGITIVE… |
| A0A818HB37 | 18-214 | None |
| N1R4Z5 | 85-208 | None |
| A0A2H5RA39 | 7-170 | None |
| U6MWQ5 | 1-263 | None |
| A0A453PNF5 | 15-172 | None |
| A0A453PNK2 | 52-216 | None |
| A0A1X7TUR4 | 8-172 | None |
| A0A5B7D429 | 6-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.