DPCstruct | MC23664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1PBI4 | 40-120 | VTDWTTLVLTDHRPYKLSEDDFHRVCRVPHKKGANFRDFPGVIVDSNNTVHRDRTKEVLLPSGKPLLPDYVFTFEKGKSRR |
| A0A453TBI0 | 5-92 | KGQLFDHQPLQLNNDDYERVQQIPEKKGANFRDLKGVRVGAKNTVEFNPNIPRALLSSGKPLVPDYAMSFIKGKSSKPFRRLWWDETV |
| A0A7J6WAT1 | 378-467 | None |
| A0A2P5FA94 | 4-89 | None |
| A0A811MN60 | 9-95 | None |
| A0A6D2IS11 | 241-328 | None |
| A0A314LBW1 | 9-95 | None |
| A0A287P773 | 241-338 | None |
| A0A2G2VUB2 | 227-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.