DPCstruct | MC23662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.23 |
| Pfam Score | 90.38 |
| Assigned Pfam label(s) | CL0039- PF20979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0RX55 | 94-244 | RPVIARAQVAVAQKEGCFAVSHGCTGKGNDQVRFELAFYALQPSIKVIAPWRDPAFYERFKGRQDLLDYATEKGIPVTSTKRKPWSM… |
| A0A2U1P2J2 | 2-108 | TLPHGCTGKGNDQVRFELTFIALNPDLHVVAPWREWDITGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEVPITRINTMFPL… |
| A0A5N6NWS3 | 183-313 | None |
| A0A0R0IGZ2 | 2-94 | None |
| A0A7V1K436 | 4-93 | None |
| A0A6L5C892 | 370-460 | None |
| A0A5J5CR08 | 106-240 | None |
| A0A812IRJ5 | 350-443 | None |
| A0A7R9KWP3 | 31-173 | None |
| A0A2M6YG27 | 118-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.