DPCstruct | MC23659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 8.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.01 |
| Pfam Score | 97.95 |
| Assigned Pfam label(s) | CL0265- CL0367- CL0521- PF06792 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9RGM3 | 56-120 | KCLADEATKLIGQSGLSEEQIKQKTKSEIVRSVGPNQPVTMDYRENRVTVTIDPQSKKIVQATCG |
| A0A2U1NXQ3 | 10-84 | PSVEVQQTVPTSKTSWPEVVGRTAEEAEKKIKEDMPGATVQVIPHDSFVTMDFNSNRVRLFVDSSQLVVKAPHIG |
| A0A1G6Y459 | 202-256 | None |
| A0A0D9VBL1 | 158-227 | None |
| A0A1R3KQG0 | 5-73 | None |
| A0A6V7PDG0 | 120-198 | None |
| A0A1E7FIW4 | 245-316 | None |
| A0A0D3D8P1 | 73-140 | None |
| A0A1E7FJI5 | 393-476 | None |
| A0A3S3QNC6 | 118-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.