DPCstruct | MC23650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 172 ± 30 aa |
| Standard deviation of domain lengths | 29.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 93.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.12 |
| Pfam Score | 94.49 |
| Assigned Pfam label(s) | PF04961- PF02971 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7V599 | 5-157 | AVEPQVWPILERAEEVRRELEALVSEDAAAFEAVMAARRLPKATEEQKAARQQAILEATRKAAQVPLRTARLAAEVLDLAGQMAAIG… |
| A0A841FJG2 | 13-191 | LADRVPAPGGGASAALHAAQAAALLAMVARYTRAGEHAETIARVTAEADALRDRALTLAEDDAAAFTAVTDAYKLPKATDDDKKARS… |
| A0A7Z9JZ52 | 209-410 | None |
| A0A7J7ZV37 | 8-172 | None |
| A0A2N2PAR5 | 614-777 | None |
| A0A0J5X3C8 | 7-216 | None |
| A0A838KQM0 | 7-147 | None |
| H1Y457 | 35-233 | None |
| A0A2H0P3Q9 | 173-357 | None |
| A0A3S1AUH2 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.