DPCstruct | MC2365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 7.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 53.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0JVD7 | 8-74 | PLPDDTFTRAQAEAVVAQFENVAIEDDQGSHFRLVVRQNGEMVWQAWNFEADAGIWLNRYIERYGIR |
| A0A486W0Q9 | 1-73 | MPLHTLLPPGPFLRGQAEKVVATYLNATIEDDQGTHFRLVIRDSDNQLIWRAWNFETEAGYWLNRYLVSHGIP |
| A0A6D0VH92 | 4-62 | None |
| A0A6L7A0R3 | 28-96 | None |
| A0A029H1A8 | 1-58 | None |
| A0A5D4JCE2 | 4-67 | None |
| A0A830WWB9 | 6-65 | None |
| A0A2V2BCB0 | 68-141 | None |
| A0A447W1M0 | 2-58 | None |
| A0A743SN64 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.