DPCstruct | MC23646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 98 ± 13 aa |
| Standard deviation of domain lengths | 12.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R8H4Z8 | 62-166 | LIEAYYKFAKSKEGGFSNGNSRANKVNILESSIKHSNVGDFTTHPKTGDISKMKGGGHGQSNIEFLEKNNVDYNINKVYENGVRVGV… |
| B5ZBU6 | 19-98 | VSEFCFVHVNEGKFVNANDKNKIRLHTGGHGQANIELLKRLRIGYEINLIFENGVRVGNVENHKNNCKSKNNGQTWLPKS |
| Q5KTB5 | 571-681 | None |
| A0A7M3FQR1 | 1-105 | None |
| B5ZBU4 | 1-80 | None |
| A0A6B4LBB6 | 172-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.