DPCstruct | MC23644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 174 ± 34 aa |
| Standard deviation of domain lengths | 34.16 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1S777 | 293-417 | SSGFELSFSYCMVTLQRPWMLPQVFNLSNLWYSLAAKAGFYSTGEMSNNNGVMRALPKAMIVIKDLKIKASKWSEEDKRIAQSAFGF… |
| A0A6I5PII3 | 27-183 | GSFASSSSAEHFHMDAENVEISAKLQVVRIMRPWLNSLIFQLSNWWMQGVAVNGVSTGSLTDNVDSLLPLIPTAFVVMSDVEIKADF… |
| A0A0C9T7P8 | 171-334 | None |
| A0A0C9ULC4 | 167-328 | None |
| A0A0S7DL54 | 511-744 | None |
| A0A418R626 | 197-321 | None |
| A0A4R5M697 | 209-346 | None |
| A0A0J9WSI5 | 344-484 | None |
| A0A619AH81 | 53-252 | None |
| A0A6P0PUT9 | 77-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.