DPCstruct | MC23641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 136 ± 23 aa |
| Standard deviation of domain lengths | 22.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7J0U9 | 1-167 | MSKAALRKELVKMSQEQLVTLILDLYSARPQAKEYFEFFLNPDEKELYDKYVKIVEKEVYRSKRGMLCARVSYLNAYIKDFASFGVS… |
| A0A6I5NTE6 | 3-134 | TSGPKVSELKRYLSHRSQAELVKEIAELFKRIPAVKDYYQVKLNPQAEDDVADKYKAIIRHEFSTDFAPGPGRLSIARKAVMDFKKV… |
| A0A520KVW3 | 1-99 | None |
| A0A358U5U2 | 1-141 | None |
| I9LE57 | 2-91 | None |
| A0A6V8MAM9 | 94-247 | None |
| A0A318D4V0 | 16-151 | None |
| A0A0E3QDL3 | 1-149 | None |
| R4KDC0 | 5-139 | None |
| A0A7T6Z1W1 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.